PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 515aa    MW: 59213.9 Da    PI: 6.8174
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504090.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.77.9e-17110191590
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++ l+ g l+lp +fa+  ++k  ++  l+++de+ r W++kl+ + +++r+ +++GW++F  +n+LkegD +vF+++ ++e+
  XP_016504090.1 110 TIKPYCLTYGYLYLPQQFANGLSNK--KG-NLIIRDERQRLWNLKLS-SDYKKRVRIGDGWRKFIADNRLKEGDRIVFEVVTDEET 191
                     578999999*********9555444..33.6999************6.6666799************************8876544 PP

2B347.92.5e-15265345589
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     +++++ l+ g l+lp +fa+  + +ke+  +l+++de+ r W++kl+ + +++r+ +++GW++F  +n+Lk gD ++F+++ ++e
  XP_016504090.1 265 TIKPYCLTYGYLYLPQPFANGLS-NKEC--DLIIRDERQRLWNLKLS-SDCKNRVRIGDGWRKFIVDNRLKKGDRIMFEVVTDEE 345
                     578999999*********94443.3344..8***************5.7788889************************876543 PP

3B361.31.6e-19402491597
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++++++ +++r+ +pk fa+e+g+++++  t++++d + rsWe++l y+ + g++++++ W++F+ an LkegD ++F+    +++++ +k++
  XP_016504090.1 402 TVKPHHISKCRMHVPKLFARENGLSNRQ-CTIVIRDYEQRSWEFRL-YSSCAGSTFIGGEWRKFCAANFLKEGDCIMFEIFA-KGEKPILKFY 491
                     56899999**************999765.6****************.9999999*************************544.7777777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.71E-17104196IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-18104196IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.437106202IPR003340B3 DNA binding domain
CDDcd100177.48E-13106184No hitNo description
SMARTSM010193.5E-12107199IPR003340B3 DNA binding domain
PfamPF023621.5E-14110191IPR003340B3 DNA binding domain
SuperFamilySSF1019361.28E-15259346IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-16259344IPR015300DNA-binding pseudobarrel domain
CDDcd100174.07E-12261339No hitNo description
PROSITE profilePS5086312.59261356IPR003340B3 DNA binding domain
SMARTSM010193.1E-8262353IPR003340B3 DNA binding domain
PfamPF023622.5E-13265345IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.0E-19395489IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.464398496IPR003340B3 DNA binding domain
CDDcd100171.47E-18398492No hitNo description
SuperFamilySSF1019368.63E-19398490IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.6E-13399494IPR003340B3 DNA binding domain
PfamPF023627.6E-18402491IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MEFEVMIFDS SHCNREYAEY LQEEEAAATH TFGEASKNFE FEDTNNYASI PSGDQLYESS  60
PSMSCYLIHS RNTDDVIEIP SPGIKLSDED SSHAEAASDK HVGHSHFVCT IKPYCLTYGY  120
LYLPQQFANG LSNKKGNLII RDERQRLWNL KLSSDYKKRV RIGDGWRKFI ADNRLKEGDR  180
IVFEVVTDEE TSIWKFHVVT NAKTPMRKFQ GGHGLEPWKQ PLAEIPSPDN VVEIPSPGIK  240
SSDEDSSHAE TATDKHVGHS HFVCTIKPYC LTYGYLYLPQ PFANGLSNKE CDLIIRDERQ  300
RLWNLKLSSD CKNRVRIGDG WRKFIVDNRL KKGDRIMFEV VTDEESIWKF HAVTNAETPM  360
RKFQANATEK PEPNIMSSYK AFPDVEAAKD MPLSHPDHFI STVKPHHISK CRMHVPKLFA  420
RENGLSNRQC TIVIRDYEQR SWEFRLYSSC AGSTFIGGEW RKFCAANFLK EGDCIMFEIF  480
AKGEKPILKF YDLRANASLQ PEEWKPNLDA KRVST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016504092.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X3
RefseqXP_016504091.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X3
RefseqXP_016504090.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X3
TrEMBLK4CIA91e-103K4CIA9_SOLLC; Uncharacterized protein
STRINGSolyc08g006200.1.11e-102(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-24B3 family protein